PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c14_22180V3.2.p
Common Namem3, PHYPADRAFT_179228, PPM3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MIKC_MADS
Protein Properties Length: 373aa    MW: 41822.7 Da    PI: 7.3816
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c14_22180V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF84.27.6e-27959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        k+ien+ nrqvt+skRrng+ KKA+ELSvLCd++ a+i+fs++gkl  ys+
  Pp3c14_22180V3.2.p  9 KKIENSANRQVTYSKRRNGLTKKAYELSVLCDIDLALIMFSPSGKLTQYSN 59
                        68***********************************************85 PP

2K-box14.31.7e-06110199993
               K-box   9 leeakaeslqqelakLkkeienLqreqRhllGed..LesL.slkeLqqLeqqLekslkkiRskKnell..leqieelqkkekelqeenka 93 
                          ++++ e lq+el+k + e e +q+ +R +l ++  L+s  s+++L ++e++Le++l+++R++K  +   ++ ++ +q+++ +lq ++++
  Pp3c14_22180V3.2.p 110 SKSEEVELLQEELKKTQHEKELIQQRIRLYLADEqlLQSVtSVQQLANMETELEQALERVRTRKAYVTsaYQAVSVMQRQMLALQAQQQK 199
                         56788999********************999876557776479*********************98862145677777777777766665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.539161IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-34160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.1E-31292IPR002100Transcription factor, MADS-box
CDDcd002652.01E-36271No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-25323IPR002100Transcription factor, MADS-box
PfamPF003198.1E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-253859IPR002100Transcription factor, MADS-box
PROSITE profilePS512978.986115220IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000006anatomyplant protoplast
PO:0025017anatomyplant spore
PO:0030003anatomyprotonema
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MGRVKLEIKK IENSANRQVT YSKRRNGLTK KAYELSVLCD IDLALIMFSP SGKLTQYSNC  60
SIEDIIDRFA NLPTQERNKR KIENLEYLQK ALRKLTGEKE WVPNQIISGS KSEEVELLQE  120
ELKKTQHEKE LIQQRIRLYL ADEQLLQSVT SVQQLANMET ELEQALERVR TRKAYVTSAY  180
QAVSVMQRQM LALQAQQQKQ QRDTLGQQPL PLQWNNPECG HSMLQEFMDQ HANPQAIVPV  240
QHMNREMGSN SEASPSSFFS QSGSQSNLHN LAGQLNLVGA NRGLNIHDMA LERSGSGQYD  300
EQKKSKGGAN AGFASSSSSG AAAEGSAETF TGQSEPNASN WQLSHQAHHH MHAYSSAQYP  360
TGFSNQNEEA WK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-16190190Myocyte-specific enhancer factor 2B
1tqe_Q1e-16190190Myocyte-specific enhancer factor 2B
1tqe_R1e-16190190Myocyte-specific enhancer factor 2B
1tqe_S1e-16190190Myocyte-specific enhancer factor 2B
3mu6_A1e-16269168Myocyte-specific enhancer factor 2A
3mu6_B1e-16269168Myocyte-specific enhancer factor 2A
3mu6_C1e-16269168Myocyte-specific enhancer factor 2A
3mu6_D1e-16269168Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.1460.0gametophore| protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4193290.0AJ419329.1 Physcomitrella patens mRNA for putative MADS-domain transcription factor (m3 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001758937.10.0MIKC MADS-domain protein PPM3
RefseqXP_001758938.10.0MIKC MADS-domain protein PPM3
TrEMBLA9RXS70.0A9RXS7_PHYPA; MIKC MADS-domain protein PPM3
STRINGPP1S34_373V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.11e-34AGAMOUS-like 104
Publications ? help Back to Top
  1. Henschel K, et al.
    Two ancient classes of MIKC-type MADS-box genes are present in the moss Physcomitrella patens.
    Mol. Biol. Evol., 2002. 19(6): p. 801-14
    [PMID:12032236]
  2. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]